Y

YouLibs

Remove Touch Overlay

Eva & Tom Do A Musical | "Deception Check" Behind The Scenes

Duration: 10:27Views: 52.9KLikes: 4KDate Created: Jun, 2021

Channel: Deerstalker Pictures

Category: Film & Animation

Tags: web-seriescosplaysorcererlarpcritical faildeception checkfilmmaking5th editionmmommorpgtabletop game5eweekend at bernie'sdungeons and dragonsdungeon mastercritical successhigh elfbehind the scenescritical rolelive actiondndhumanfightelfbardbts1 for alld&dd20fantasykingcomedyrpgmedievalregicidedeerstalker picturestieflingking jeraldttrpghalf-elfskitmaking ofrole playing gameseason 3weekend at jerald's

Description: Watch "Deception Check" here: youtu.be/JNNY1ouCByw Written & Directed by Elliot Ryan – @technotropism Produced by Goldie Soetianto and Vincent Power Executive Producer: Goldie Soetianto – @vysanthe Starring: Evandra / Eva: Eva Devore – @eva_devore Antrius / Antonio: Forgeling – @forgeling Nixie / Nicole: Fall Cosplay – @fallcosplay The King's Advisor / Patrick: Kendall Drury – @kendallthehuman King Jerald – Sam Wade Guards – Eli Gallagher & Ryan Ash Cat Percer: Lumi – @little.lumi.cat Script Editor: Vidya Rajan Script Supervisor: Fern Mei Sim Storyboard Artist: Yumi Young 1st Assistant Director: Vincent Power Unit Manager: Nick Barraclough Production Assistant: Fern Mei Sim Runner: Manul Japeth ‘MJ’ Gunaratne Director of Photography: Goldie Soetianto 1st Assistant Camera: Neal Von Dinklage 2nd Assistant Camera: Vivian Duong Stills Photographer: Etienne Reynaud BTS Videographer: Jasmine Suivi Gaffer: James Gilligan Sound Recordist: Gareth Evans Costume Designer: Laura Cagnacci Additional Costume Design: Thomas Taufan Standby Wardrobe: Rob Mason Nixie's Tail Provided by Cosgear – cosgear.co SFX Make-up Artist: Jennifer Pryer Assistant Make-up Artist: Andre Knite Art Director: Kavi Jarrot Props Master: Thomas Taufan Standby Props & Set Dressing: Kavi Jarrot & Rob Mason Editor: Elliot Ryan Assistant Editor: Jacob Hogarth Colourist: Goldie Soetianto Visual Effects: Ken Abbot BTS Editor: Nicole Hadjimichael Composer: Ned McPhie Sound Design: Ned McPhie Sound Mix: Ned McPhie Legal Advice: Sam Berry Production Accounting: Matthew Carter Locations Manager: Vincent Power Nurse & Covid Safety: ‘Sabrina’ Palepu Timu Catering: Café Giulia Chef: Stefan Stavropoulos Logo: The Wonyo Intro Sequence: Reuben Jurott Special thanks to: Sam Berry & Chris Chow Lawyers, Matthew Carter and Above the Line Accounting, Kiln Studios, Rolando Ramos & Lindesay House, Cale Bain & Improv Theatre Sydney, Camera Hire Alexandria, Debra Vo, Gabrielle Ferguson and SCREEN AUSTRALIA Translators Italian: Damiano Panada Spanish: Judith Ramirez French: Yohan Morel Portuguese: Hesblan Harley Russian: Loki & Snack German: Marius Müller This production was supported by Screen Australia through the COVID-19 Budget Support Fund Program. Support future videos: ► Patreon: patreon.com/deerstalkerpictures ► Merch: colabmerch.com.au/1forall Follow us: ► Twitter: twitter.com/deerstalkerpics ► Instagram: instagram.com/deerstalkerpictures ► Facebook: facebook.com/deerstalkerpictures #1ForAllSeason3 #1ForAllDnD

Swipe Gestures On Overlay